PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016487636.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 276aa    MW: 30340 Da    PI: 10.5683
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016487636.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.12.4e-1485129347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++l++ + ++ G+g+W+ I+r + k+Rt+ q+ s+ qky
   XP_016487636.1  85 PWTEEEHKLFLLGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKY 129
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.6778134IPR017930Myb domain
SuperFamilySSF466895.23E-1780134IPR009057Homeodomain-like
TIGRFAMsTIGR015574.6E-1781132IPR006447Myb domain, plants
SMARTSM007171.8E-1082132IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-1184129IPR009057Homeodomain-like
CDDcd001671.32E-985130No hitNo description
PfamPF002491.5E-1185129IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
AAVSGGGGEI MLFGVRVKVD PMRKSVSLNN LSQYELPNAN ENINNISNSG NNNEYSKVAD  60
EGYASADDAV PRHSGSGRER KRGVPWTEEE HKLFLLGLQK VGKGDWRGIS RNFVKTRTPT  120
QVASHAQKYF LRRTNLNRRR RRSSLFDITT DSVSVVPIEE KQNLQEHQVL APTSLPPVKN  180
SKINAFQVTP LPVTFGQGDQ INKNSSIFLR PVPVLPLSNS SRIADFNLNQ SSAMEASSLS  240
LTLSLSLNQS QSSSTRHSAF QVMSNFNNGD SIISVA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU5608991e-139EU560899.1 Capsicum annuum clone DEG202 MYB transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009760664.10.0PREDICTED: transcription factor MYB1R1-like
SwissprotQ2V9B01e-102MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLK4BKL41e-111K4BKL4_SOLLC; Uncharacterized protein
STRINGSolyc03g113620.2.11e-111(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA25742351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19000.21e-57MYB_related family protein